DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and sec14l7

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_009303977.1 Gene:sec14l7 / 566865 ZFINID:ZDB-GENE-141216-145 Length:405 Species:Danio rerio


Alignment Length:289 Identity:67/289 - (23%)
Similarity:122/289 - (42%) Gaps:60/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RLGYLKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGAL 78
            |:|.|.|:               :|||:.:.||.|:...:......|.:|..:|||..|....|.
Zfish    17 RVGDLSPK---------------QAEALTQFREKLEDVWDQLSNQTDHYLLRWLRARTFNVPKAE 66

  Fly    79 EKMKTTASFRK--EYASLVRGLLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDP---- 137
            ..::....||:  :..:::......:|.|::|.|.:...    |::|..:.....|.| ||    
Zfish    67 AMLRKHLEFRRHMKLETIIDDWSPPEVLERYVAGGMCGY----DREGSPIWFDIIGPL-DPKGLL 126

  Fly   138 ----------SDITSDEMFRMLYMVHLAAQLEEETQ-----VRGVVCIMDFEGLSMKQVKALSPS 187
                      :.|...|:.|        .:.|::::     :..:..|.|.|||.||.:...:..
Zfish   127 LSASKQDCLRTKIRDAELLR--------RECEKQSKKLGKHIESITIIYDCEGLGMKHLWKPAVE 183

  Fly   188 FSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKS-LQKFLDP 251
            ....:||..:|..|..:|:|..:|.|.:|.:.::|.|.|::::...::...||:.|. |:.::|.
Zfish   184 MYGEILTMYEENYPESLKKVLLIKAPKLFPIAYNLVKHFLREETRQKIAVLGSNWKDVLKNYVDA 248

  Fly   252 SVLPANYKGTLPAID----------YGGV 270
            ..:||.|.|:|...|          ||||
Zfish   249 DQIPAAYGGSLTDPDGNPLCTTMLRYGGV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 13/43 (30%)
CRAL_TRIO 111..261 CDD:279044 37/169 (22%)
sec14l7XP_009303977.1 CRAL_TRIO_N 26..72 CDD:215024 13/45 (29%)
CRAL_TRIO 97..258 CDD:279044 39/173 (23%)
GOLD_2 317..395 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.