DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and Sec14l4

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001102560.1 Gene:Sec14l4 / 498399 RGDID:1565810 Length:412 Species:Rattus norvegicus


Alignment Length:292 Identity:63/292 - (21%)
Similarity:119/292 - (40%) Gaps:69/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RLGYLKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGAL 78
            ::|.|.|:               :.||:.:.||:|:.......|.||.||..:|||.:|..:.:.
  Rat     4 QVGDLSPQ---------------QQEALTRFREILQDVLPTLPKADDFFLLRWLRARNFDLKKSE 53

  Fly    79 EKMKTTASFRKEYASLVRGLLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCG------KLW-- 135
            :.::....||.:..  :..:|..|..|         |::..|..|.      ||      .:|  
  Rat    54 DMLRKHVEFRNQQD--LDHILTWQPPE---------VIRLYDSGGL------CGYDYEGCPVWFD 101

  Fly   136 -----DPSDI----TSDEMFR--------MLYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQVKA 183
                 ||..:    :..::.|        :|:...|.:| :...:|..:|.:.|.||||::.:..
  Rat   102 LIGTLDPKGLFMSASKQDLIRKRIKVCEMLLHECELQSQ-KLGRKVERMVMVFDMEGLSLRHLWK 165

  Fly   184 LSPSFSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMK-SLQK 247
            .:....::....::...|..:|.:..::.|.:|.:.::|.|.|:.:....::...|.:.| .|.|
  Rat   166 PAVEVYQQFFAILEANYPETVKNLIVIRAPKLFPVAFNLVKSFIGEVTQKKIVILGGNWKQELLK 230

  Fly   248 FLDPSVLPANYKGT----------LPAIDYGG 269
            |:.|..||..:.||          |..|:|||
  Rat   231 FMSPDQLPVEFGGTMTDPDGNPKCLTKINYGG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 14/43 (33%)
CRAL_TRIO 111..261 CDD:279044 34/175 (19%)
Sec14l4NP_001102560.1 CRAL_TRIO_N 13..59 CDD:215024 14/45 (31%)
SEC14 76..244 CDD:214706 35/183 (19%)
GOLD_2 284..379 CDD:404736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.