DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and sec14l5

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_031749906.1 Gene:sec14l5 / 493292 XenbaseID:XB-GENE-953433 Length:793 Species:Xenopus tropicalis


Alignment Length:279 Identity:66/279 - (23%)
Similarity:121/279 - (43%) Gaps:58/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PETVEIARVELRETEEVKAEA-----------------IIKLRELLKATPELNYKDDDAFLTVFL 67
            |.:...|..||..|.:.|.:|                 :|:||:.|:.|.:.....|:..|. ||
 Frog   221 PSSPTAATHELSSTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILR-FL 284

  Fly    68 RACHFYPEGALEKMKTTASFRKEYASLVRGLL----VEQVKEKFVKGSVINVLKNCDQKGRRVLI 128
            ||..|..:.|.|.:..:.::||::.  |..||    ..||...:..|.    ..:.|:.||.:.:
 Frog   285 RARDFNIDKAREILCQSLTWRKQHH--VDYLLSTWDPPQVLHDYYAGG----WHHHDRDGRPLYV 343

  Fly   129 VNCGKLWDPSDIT----SDEMFRMLYMVHLAA--QLEEETQVRG-----VVCIMDFEGLSMKQ-- 180
            :..|:: |...:.    .:.:.|.:..::...  :.||.|.:.|     ..|::|.|||:|:.  
 Frog   344 LRLGQM-DTKGLVRALGEESLLRHVLSINEEGLRRCEENTNIFGRPISSWTCLVDLEGLNMRHLW 407

  Fly   181 ---VKALSPSFSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHF---HG 239
               ||||     .|::..::...|..:..:..::.|.:|.::|:|..||:.:  |.|..|   .|
 Frog   408 RPGVKAL-----LRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDE--NTRKKFLIYAG 465

  Fly   240 SDMK---SLQKFLDPSVLP 255
            :|.:   .|..::|..|:|
 Frog   466 NDYQGPGGLIDYIDKEVIP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 15/60 (25%)
CRAL_TRIO 111..261 CDD:279044 37/167 (22%)
sec14l5XP_031749906.1 PRELI 17..173 CDD:398400
CRAL_TRIO_N 256..301 CDD:215024 14/45 (31%)
CRAL_TRIO 326..490 CDD:395525 38/171 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.