DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and CG11550

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster


Alignment Length:230 Identity:57/230 - (24%)
Similarity:107/230 - (46%) Gaps:6/230 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMKTTASFRKEYASLVRGLL 99
            |::...::|..:.:.|.|.::.:..:.....|..||.:..|.|.:.:.|..:.|.........|.
  Fly    15 EIRRPEVLKFLDWIHAQPHISDRFSEGEALHFFHACRYSMEVAKQVLDTNLTARTHLEEFFVNLD 79

  Fly   100 VEQVKEKFVKGSV-INVLKNCDQKGRRVLIVNCGKLWDPSDITSDEMFRMLYMVHLAAQLEEETQ 163
            .|:.:.:....:| |..|.....:|.||::.....| :.|:....::.::..||......|:..|
  Fly    80 CERPEIRRAMRTVSIVPLPGATPEGYRVILAKLDDL-NTSNYNFADVMKLYCMVFDFWMYEDGIQ 143

  Fly   164 VRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMKEVHFVK-QPFIFNMVWSLFKPFV 227
             .|.|.::|.:..|:..|..:.....|:.|.::|||..:|:...||:. .||: :.:.:|..||:
  Fly   144 -PGHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINIVPFM-DKILALMTPFM 206

  Fly   228 KQKLNNRMHFHGSDMKSLQKFLDPSVLPANYKGTL 262
            |::|...:|.| ||:|...||:...:||..|.|.|
  Fly   207 KKELTTVLHMH-SDLKEFYKFVPQEMLPKEYGGQL 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 8/43 (19%)
CRAL_TRIO 111..261 CDD:279044 42/151 (28%)
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 41/148 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.