DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and CG33523

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:175 Identity:32/175 - (18%)
Similarity:74/175 - (42%) Gaps:12/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KDDDAFLTVFLRACHFYPEGALEKMKTTASFRKEYASLVRGLLVEQVKEKFVK-GSVINVLKNCD 120
            ::|..:|..||.......|.:...:..|...|:...:  ..:...::.::::| |||.  :.|.|
  Fly    42 RNDHLWLQRFLEMYDLDMETSFNSLWETCILRQSTGA--NDIDESELNQEYLKEGSVF--VHNTD 102

  Fly   121 QKGRRVLIVNCGKLWDPSDITSDEMFRMLYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQVKALS 185
            ..|:.:|:... |:...|. ..||:.|:  :|:...:.:.|..:..:....|..|.|:   .::.
  Fly   103 VDGKPLLVFRV-KMHSKSK-NLDELIRI--VVYWVERTQREQHLTQLTIFFDMSGTSL---ASMD 160

  Fly   186 PSFSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQK 230
            ..|.||::...::..|..:..:...:..::.|..:.:.|..:..|
  Fly   161 LEFVKRIVETFKQFYPNSLNYILVYELGWVLNAAFKVIKAVLPPK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 5/24 (21%)
CRAL_TRIO 111..261 CDD:279044 23/120 (19%)
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 24/121 (20%)
Motile_Sperm 293..396 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.