DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and Clvs2

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001101929.1 Gene:Clvs2 / 361459 RGDID:1306801 Length:236 Species:Rattus norvegicus


Alignment Length:225 Identity:64/225 - (28%)
Similarity:113/225 - (50%) Gaps:26/225 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HLRLGYLKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNY-KDDDAFLTVFLRACHFYPE 75
            ||:.| |.|||:|.||:||.|..:...:.|.::|:::...|::.: :.||||:..||||..|:..
  Rat     3 HLQAG-LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHF 66

  Fly    76 GALEKMKTTASFRKEYASLVRGL------LVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKL 134
            .|...:.....:|::...:.:..      :.:.:|:.|..|     |.|.|..||::|::.... 
  Rat    67 EAFRLLAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGG-----LANLDHYGRKILVLFAAN- 125

  Fly   135 WDPSDITSDEMFRMLYMVHLAAQLEE-ETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQE 198
            ||.|..|..::.|.: ::.|.|.:|: |.||.|.|.|:|:...:.||...|:||    :|....|
  Rat   126 WDQSRYTLVDILRAI-LLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPS----MLRLAIE 185

  Fly   199 AMPLRMKEVHFVKQPFIFNMVWSLFKPFVK 228
            .:.:|      |...:.|.:.:.||..:|:
  Rat   186 GLQVR------VYHCYCFFVSYMLFALYVR 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 13/44 (30%)
CRAL_TRIO 111..261 CDD:279044 34/119 (29%)
Clvs2NP_001101929.1 CRAL_TRIO_N 29..75 CDD:215024 13/45 (29%)
SEC14 103..>204 CDD:301714 33/117 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59833
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 1 1.000 - - mtm9153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.