DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and CG12926

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster


Alignment Length:291 Identity:77/291 - (26%)
Similarity:121/291 - (41%) Gaps:27/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EAFHLRLGYLKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFY 73
            ||:...:..|.||..:.|..||.|..:...|.|..||..:...|.|..:.|..||..|||.|.: 
  Fly     3 EAYSNSIRSLSPELAKKAHDELGEIPDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKY- 66

  Fly    74 PEGALEKMKTTASFRKEYASLVRGLLVEQVKEKFV---------KGSVINVLKNCDQKGRRVLIV 129
               :||  ||.......||  :||.:.|..|.:.|         .|.::.:.:.....|.|:.|.
  Fly    67 ---SLE--KTKLKLDNFYA--MRGAVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHIS 124

  Fly   130 NCGKLWDPSDITSDEMFRMLYMV-HLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLL 193
            ..|: :|....:..|:.::..|: .:..:.::...:.|.|.|:|.:|:....:........|:|.
  Fly   125 RYGQ-YDSKKYSIAEVVQVNTMLGEIQIREDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLA 188

  Fly   194 TFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPANY 258
            ....:|.|.|.|..|||..|.......|:.|..:.:|:..|.|.| |.:.||.|::....|||.|
  Fly   189 VLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHIH-SKLDSLYKYVPKECLPAEY 252

  Fly   259 KGTLPAIDYGGVEW-------FPALEQQAQY 282
            .|:...|......|       .|..|::|.|
  Fly   253 GGSNGTIQDVVSTWRTKLLAYKPFFEEEASY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 15/43 (35%)
CRAL_TRIO 111..261 CDD:279044 36/150 (24%)
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 17/50 (34%)
SEC14 117..254 CDD:238099 36/138 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.920

Return to query results.
Submit another query.