DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and CG5973

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:274 Identity:97/274 - (35%)
Similarity:163/274 - (59%) Gaps:11/274 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PE-TVEIARVELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMKT 83
            || .::.|:.||||...||.:||.:||||::....||...||.::.:|||..|:|||.||:::|.
  Fly    32 PEWALKKAQDELREVPGVKEQAIKELRELIQNEKYLNLPLDDEYMMMFLRPTHYYPESALKRLKN 96

  Fly    84 TASFRKEYASLVRGLLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDPSDITSDEMFRM 148
            ....:.:|.:....::..:::..| :.:::|:|...||.|||:|::..||.|.||.:...::||.
  Fly    97 FYHMKLKYGAACENIIPSKLRNVF-EANILNLLPQRDQHGRRLLVLEAGKKWKPSQVPLVDLFRG 160

  Fly   149 LYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMKEVHFVKQP 213
            :.:..|.:.:|..:|:.|.|.|:|.|||.:..:...:|||:..||.:|||.:.:|:|.||.|...
  Fly   161 IQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRLKAVHIVNNS 225

  Fly   214 FIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPANYKGT----LPAIDYGGV--EW 272
            :||||::::||||:::||..|:.|||.|.|||...::...||..|.|:    ||   :|.|  |:
  Fly   226 YIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGGSATWELP---HGKVLGEF 287

  Fly   273 FPALEQQAQYVEEW 286
            |....:..:..:.:
  Fly   288 FECYSKDYELADSY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 19/43 (44%)
CRAL_TRIO 111..261 CDD:279044 59/149 (40%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 19/44 (43%)
SEC14 116..272 CDD:238099 60/156 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4154
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118099at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8432
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
87.970

Return to query results.
Submit another query.