DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and retm

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster


Alignment Length:256 Identity:58/256 - (22%)
Similarity:109/256 - (42%) Gaps:39/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IARVELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMKTTASFRK 89
            ||| .|.:...::...:::||::|....:|........:..||.|..::...|...:..:..:|:
  Fly   210 IAR-SLGQLSPMQESKLLELRKMLDGVDDLERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWRR 273

  Fly    90 EYASLVRGLLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDPSDITS-------DEMFR 147
            |:.  :..||.|..|...|.........:.|:.||.|.|:..|.:    |:..       |.:.|
  Fly   274 EHR--IDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHM----DVKGLLKSLGMDGLLR 332

  Fly   148 MLYMVHLAAQ----LEE-----ETQVRGVVCIMDFEGLSMKQ-----VKALSPSFSKRLLTFIQE 198
            :  .:|:..:    :.|     |..|.....::|.|||||:.     :|||     ..::..::.
  Fly   333 L--ALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKAL-----LNIIETVER 390

  Fly   199 AMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSD---MK-SLQKFLDPSVLP 255
            ..|..|..|..|:.|.:|.:.|::...|:.:...::..|:|.|   || .|.::||..::|
  Fly   391 NYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVP 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 8/43 (19%)
CRAL_TRIO 111..261 CDD:279044 39/170 (23%)
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 8/45 (18%)
CRAL_TRIO 293..456 CDD:279044 39/170 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.