DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and CG31826

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:277 Identity:69/277 - (24%)
Similarity:124/277 - (44%) Gaps:24/277 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ARVELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMKTTASFRKE 90
            |||:....:..|.|   :||:|::...:|....:|..||.||....:....|.:.:.....|::.
  Fly     6 ARVDHTAEQIFKIE---QLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRR 67

  Fly    91 YASLVRGLLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDPSDITSDEMFRMLYMVHLA 155
            :.:.|....:|..::.|.......|:...|:.| |||:|  .|..|......|.:..::.|..|.
  Fly    68 HPTWVARHPIEHYRQLFYGTHCRYVMPQADRSG-RVLVV--FKTVDGFQDYPDYLQSLVEMDDLI 129

  Fly   156 AQ---LEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQE---AMPLRMKEVHFVKQPF 214
            .:   |....|..|:..|.|.:|.:...::..||:|.|    .:.|   .:|...:.||.:::.|
  Fly   130 FESLLLLPRVQQNGITVICDLQGTNRNFLRQFSPAFMK----VVNEKNGVLPFSQRIVHIIQRGF 190

  Fly   215 IFNMVWSLFKPFVKQKLNNRMHFH-GSDMKSLQKFLDPSVLPANYKGTLPA---IDYGGVEWFPA 275
            :.::..:||.||:.::...::..| |..:..|::.:....|||.|.|  ||   :|...:  |..
  Fly   191 LMHVTSTLFMPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGG--PATNVLDTNLI--FNH 251

  Fly   276 LEQQAQYVEEWSQLGPA 292
            |.|.|:|:|:....|.|
  Fly   252 LSQNAEYLEKLQTYGKA 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 11/43 (26%)
CRAL_TRIO 111..261 CDD:279044 38/156 (24%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 12/46 (26%)
CRAL_TRIO 92..237 CDD:279044 38/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.