DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and Ptpmeg2

DIOPT Version :10

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster


Alignment Length:131 Identity:37/131 - (28%)
Similarity:62/131 - (47%) Gaps:9/131 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 MLYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMKEVHFVKQ 212
            ::|.:..|.| :.|||..|:|.|.|..|   .:........|:::||.::...|.|:|:|..|..
  Fly   207 IVYQLDSALQ-DSETQRAGLVFIYDMSG---SKYSNFDYDLSQKILTLLKGGYPARLKKVLIVTA 267

  Fly   213 PFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPANYKGTLPAIDYGGVEWFPALE 277
            |..|...:.:.:.||::||..|: |..| :..|...:....||.:..||| .:|:  ..|..:..
  Fly   268 PLWFKAPFKILRLFVREKLRERV-FTVS-VPQLALHVPRKALPIHLGGTL-EVDH--ATWLLSCR 327

  Fly   278 Q 278
            |
  Fly   328 Q 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024
CRAL_TRIO 111..260 CDD:459890 31/111 (28%)
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:469559 31/112 (28%)
PTPc-N9 529..799 CDD:350391
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.