DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and CG31636

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster


Alignment Length:251 Identity:69/251 - (27%)
Similarity:112/251 - (44%) Gaps:9/251 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LKPETVEIARVELRETEEV---KAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALE 79
            ::|....:..:.:||..|:   .|:.|..||:.:...|.|....||.||..|||...|..|.|.|
  Fly     4 VRPLNAALQEICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLERAKE 68

  Fly    80 KMKTTASFRKEYASLV--RGLLVE-QVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDPSDIT 141
            |.....:.::....:.  |.|..: ||.:....|.::.:..:.|..|.||.|:..|. :|.|...
  Fly    69 KFDRFYTLQRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGS-YDTSKHK 132

  Fly   142 SDEMFRMLYMVHLAAQLEEE-TQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMK 205
            ..::.|:..|.......|:: ..|.|.|.|||..|::...:.||.|....:..|:..||||.|.|
  Fly   133 FQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTRQK 197

  Fly   206 EVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPANYKGT 261
            .:||:..|..|...::..:.|...|:.:|:.. .||..::.:.:....||..|.||
  Fly   198 GIHFINVPAAFETGFNSLRSFFPAKIKSRISV-SSDPAAIYELVRRKYLPQEYGGT 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 18/43 (42%)
CRAL_TRIO 111..261 CDD:279044 40/150 (27%)
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 18/44 (41%)
SEC14 96..252 CDD:238099 41/157 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
44.010

Return to query results.
Submit another query.