DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and Rlbp1

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001099744.1 Gene:Rlbp1 / 293049 RGDID:1309649 Length:317 Species:Rattus norvegicus


Alignment Length:261 Identity:88/261 - (33%)
Similarity:142/261 - (54%) Gaps:15/261 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LKPETVEIARVELRETEEVKAEAIIKLRELLK-----------ATPELNYKDDDAFLTVFLRACH 71
            |...|::.|:.||.|.||.:.||:.:|:||::           |..|.....|.|||..|:||..
  Rat    40 LPRHTLQKAKDELNEREETRDEAVRELQELVQAQAASGEELAVAVAERVQARDSAFLLRFIRARK 104

  Fly    72 FYPEGALEKMKTTASFRKEYASLVRGLLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWD 136
            |....|.|.:|...:||.:|..|...|.:|.:: ..::.....||.:.|:.||.|::.|. :.|.
  Rat   105 FDVGRAYELLKGYVNFRLQYPELFDSLSMEALR-CTIEAGYPGVLSSRDKYGRVVMLFNI-ENWH 167

  Fly   137 PSDITSDEMFRMLYMVHLAAQLE-EETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAM 200
            ..::|.||:.: .|...|...|| ||||:.|...:.:|:|.:|:|...|.||..|:::..:|::.
  Rat   168 CEEVTFDEILQ-AYCFILEKLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLKKMVDMLQDSF 231

  Fly   201 PLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPANYKGTLPAI 265
            |.|.|.:||:.||:.|...:::.|||:|.||..|:..||.|:....:.:|.::|||::.||||..
  Rat   232 PARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENILPADFGGTLPKY 296

  Fly   266 D 266
            |
  Rat   297 D 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 17/54 (31%)
CRAL_TRIO 111..261 CDD:279044 51/150 (34%)
Rlbp1NP_001099744.1 CRAL_TRIO_N 60..117 CDD:215024 18/56 (32%)
CRAL_TRIO 143..292 CDD:279044 51/150 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68046
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 1 1.000 - - mtm9153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.