DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and Sec14l5

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001129182.2 Gene:Sec14l5 / 287060 RGDID:1564638 Length:696 Species:Rattus norvegicus


Alignment Length:309 Identity:70/309 - (22%)
Similarity:133/309 - (43%) Gaps:68/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LGYLKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALE 79
            ||:|.|               ::...:::||..|:.|.:.....|:..|. ||||..|:.:.|.:
  Rat   235 LGHLSP---------------MQESCLVQLRRWLQETHKGKIPKDEHILR-FLRARDFHLDKARD 283

  Fly    80 KMKTTASFRKEYASLVRGLLVEQVK-----EKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDPSD 139
            .:..:.|:||::..   .||::..:     ::|..|.    ....|..||.:.|:..|:: |...
  Rat   284 MLCQSLSWRKQHQV---DLLLQTWRPPAPLQEFYAGG----WHYQDIDGRPLYILRLGQM-DTKG 340

  Fly   140 ----ITSDEMFRMLYMVHLAAQLEEETQVR-------GVVCIMDFEGLSMKQ-----VKALSPSF 188
                :..:.:.:.:..|:...|...|...|       ...|::|.|||:|:.     ||||    
  Rat   341 LMKAVGEEALLQHVLSVNEEGQKRCEGNTRQFGRPISSWTCLLDLEGLNMRHLWRPGVKAL---- 401

  Fly   189 SKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHF---HGSDMK---SLQK 247
             .|::..:::..|..:..:..|:.|.:|.::|:|..||:.:  |.|..|   .||:.:   .|..
  Rat   402 -LRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLVSPFINE--NTRRKFLIYSGSNYQGPGGLVD 463

  Fly   248 FLDPSVLPANYKG-TLPAIDYGGVEWFPAL-------EQQAQYVEEWSQ 288
            :||..|:|....| ::..:..||:  .|..       ::||..:.:||:
  Rat   464 YLDKDVIPDFLGGESVCNVPEGGM--VPKSLYLTEEEQEQADQLRQWSE 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 12/43 (28%)
CRAL_TRIO 111..261 CDD:279044 40/172 (23%)
Sec14l5NP_001129182.2 PRELI 17..173 CDD:309720
Amidase <179..309 CDD:327489 21/92 (23%)
CRAL_TRIO_N 243..288 CDD:215024 12/45 (27%)
CRAL_TRIO 314..477 CDD:306996 40/174 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.