DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and SEC14L3

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_011528430.1 Gene:SEC14L3 / 266629 HGNCID:18655 Length:412 Species:Homo sapiens


Alignment Length:293 Identity:70/293 - (23%)
Similarity:120/293 - (40%) Gaps:71/293 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RLGYLKPETVEIARVELRETEEVKAEAIIKLRE----LLKATPELNYKDDDAFLTVFLRACHFYP 74
            |:|.|.|:               :||.:.|.||    :|.|.|    ..||.||..:|||.:|  
Human     4 RVGDLSPK---------------QAETLAKFRENVQDVLPALP----NPDDYFLLRWLRARNF-- 47

  Fly    75 EGALEKMKTTASFRKEYASLVRGLLVE--------QVKEKFVKGSV-----------INVLKNCD 120
                :..|:.|..|| |....:.:.::        :|.:|::.|.:           .:::...|
Human    48 ----DLQKSEALLRK-YMEFRKTMDIDHILDWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLD 107

  Fly   121 QKGRRVLIVNCGKLWDPSDITSDEMFRMLYMVHLAAQLEEE---TQVRGVVCIMDFEGLSMKQVK 182
            .||   |:.:..|    .|:...:|.....::| ...|:.|   .::..:|.|.|.|||.:|...
Human   108 PKG---LLFSVTK----QDLLKTKMRDCERILH-ECDLQTERLGKKIETIVMIFDCEGLGLKHFW 164

  Fly   183 ALSPSFSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMK-SLQ 246
            .......:.....::|..|..:|.:..||...:|.:.::|.|||:.:....::...|::.| .|.
Human   165 KPLVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLL 229

  Fly   247 KFLDPSVLPANYKGT----------LPAIDYGG 269
            |.:.|..|||.:.||          |..|:|||
Human   230 KLISPEELPAQFGGTLTDPDGNPKCLTKINYGG 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 16/47 (34%)
CRAL_TRIO 111..261 CDD:279044 35/164 (21%)
SEC14L3XP_011528430.1 CRAL_TRIO_N 13..59 CDD:215024 20/56 (36%)
SEC14 76..245 CDD:214706 39/176 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.