DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and Ttpa

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_037180.1 Gene:Ttpa / 25571 RGDID:3915 Length:278 Species:Rattus norvegicus


Alignment Length:259 Identity:80/259 - (30%)
Similarity:125/259 - (48%) Gaps:22/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMKTTASFRKEYASL--------VR 96
            |.::.|...:..||......||||..||||..|..:.|...||....:|.|...|        :.
  Rat    29 AELRRRAQEEGVPETPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLHPRSIL 93

  Fly    97 GLLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDPSDITSDEMFRMLYMVHLAAQLEEE 161
            |||         |.....||::.|..|.||||... ..|||...|:.::||:..:.......|.|
  Rat    94 GLL---------KAGYHGVLRSRDPTGSRVLIYRI-SYWDPKVFTAYDVFRVSLITSELIVQEVE 148

  Fly   162 TQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPF 226
            ||..||..|.|.||..:.....::||.:|::...:.::.||:::.:|.:.:|.||:.|:|:.|||
  Rat   149 TQRNGVKAIFDLEGWQISHAFQITPSVAKKIAAVVTDSFPLKVRGIHLINEPVIFHAVFSMIKPF 213

  Fly   227 VKQKLNNRMHFHGSDMKS--LQKFLDPSVLPANYKGTLPAIDYGGVEWFPALEQQAQYVEEWSQ 288
            :.:|:..|:|.||::.||  ||.|  |.:||..|.|...:::....||...:.:...|:...|:
  Rat   214 LTEKIKGRIHLHGNNYKSSLLQHF--PDILPLEYGGNESSMEDICQEWTNFIMKSEDYLSSISE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 14/41 (34%)
CRAL_TRIO 111..261 CDD:279044 52/151 (34%)
TtpaNP_037180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CRAL_TRIO_N 25..73 CDD:215024 16/43 (37%)
CRAL_TRIO 99..248 CDD:395525 52/151 (34%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.