DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and CG30339

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:295 Identity:80/295 - (27%)
Similarity:133/295 - (45%) Gaps:41/295 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LKPETVEIARV---ELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALE 79
            |:|.:.|:.|:   ||.|.||.....:..||:.|...|.|..:.||.||..|||.|.|    :||
  Fly     4 LRPLSAELRRIAETELNEVEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKF----SLE 64

  Fly    80 KMKTTASFRKEYASLVRGLLVEQVKEKFV---------KGSVINVLKNCDQKGRRVLIVNCGKLW 135
            |.|:    :.::...::.|:.|...::.|         .|:.:.:.|.....|.|:.:.|..| :
  Fly    65 KTKS----KLDHFYTIKTLMPELFGKRLVDERNLILCRSGTYVRLPKPWGTDGPRLQLTNYEK-F 124

  Fly   136 DPSDITSDEMFRMLYMV-HLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEA 199
            ||.:....::||...|: ..:.:.::.:.:.|.|.|:|...:|:..:..|..:..||:..|.::|
  Fly   125 DPKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKA 189

  Fly   200 MPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPANYKGTLPA 264
            .|.|:|.||.:..|.....:.:|.|..:..||..|.|.:    |:|::..:  |:|..|   ||.
  Fly   190 QPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVY----KNLEQLNE--VIPREY---LPE 245

  Fly   265 IDYGG---------VEWFPALEQQAQYVEEWSQLG 290
             :|||         .|....|.....|..|.||.|
  Fly   246 -EYGGNNGRIADIQAEAEKKLLSYESYFAEDSQYG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 17/43 (40%)
CRAL_TRIO 111..261 CDD:279044 37/150 (25%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 18/49 (37%)
CRAL_TRIO 109..250 CDD:279044 40/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
54.920

Return to query results.
Submit another query.