DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and Clvs2

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_780657.1 Gene:Clvs2 / 215890 MGIID:2443223 Length:327 Species:Mus musculus


Alignment Length:265 Identity:80/265 - (30%)
Similarity:146/265 - (55%) Gaps:16/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HLRLGYLKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNY-KDDDAFLTVFLRACHFYPE 75
            ||:.| |.|||:|.||:||.|..:...:.|.::|:::...|::.: :.||||:..||||..|:..
Mouse     3 HLQAG-LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHF 66

  Fly    76 GALEKMKTTASFRKEYASLVRGL------LVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKL 134
            .|...:.....:|::...:.:..      :.:.:|:.|..|     |.|.|..||::|::.... 
Mouse    67 EAFRLLAQYFEYRQQNLDMFKSFKATDPGIKQALKDGFPGG-----LANLDHYGRKILVLFAAN- 125

  Fly   135 WDPSDITSDEMFRMLYMVHLAAQLEE-ETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQE 198
            ||.|..|..::.|.: ::.|.|.:|: |.||.|.|.|:|:...:.||...|:|:..:..:..:|:
Mouse   126 WDQSRYTLVDILRAI-LLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPNMLRLAIEGLQD 189

  Fly   199 AMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPANYKGTLP 263
            :.|.|...:|||.||:..:.::::.:||:|:|...|:..||:::.||.:.:.|.:||:.:.|.||
Mouse   190 SFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLP 254

  Fly   264 AIDYG 268
            ..|.|
Mouse   255 PYDMG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 13/44 (30%)
CRAL_TRIO 111..261 CDD:279044 45/150 (30%)
Clvs2NP_780657.1 CRAL_TRIO_N 29..75 CDD:215024 13/45 (29%)
SEC14 106..251 CDD:238099 46/151 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59833
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 1 1.000 - - mtm8767
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.