DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and R03A10.5

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_510554.2 Gene:R03A10.5 / 181634 WormBaseID:WBGene00010985 Length:382 Species:Caenorhabditis elegans


Alignment Length:283 Identity:55/283 - (19%)
Similarity:103/283 - (36%) Gaps:73/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYP-EGALEKMKTTASFRKEY 91
            |:..:.:....:.|.:||||:|......|..|...|. :|:..:..| |....|||...:.|..:
 Worm     3 VKENDIQPYDLKKIQQLRELVKDDISEYYNTDFNILR-WLQGHNTLPIEEIARKMKFHLNLRAAW 66

  Fly    92 ASLVRGLLVEQVKEK---------------FVKGSVINVLKNCDQKGRRVLIVNCGK-------- 133
            .       ::::.:|               ...|.:.||:.|.:|         |||        
 Worm    67 N-------LDELHKKERNHPIHKHWKYGITGPSGHMDNVIVNIEQ---------CGKTDYTGMME 115

  Fly   134 LWDPSDITSDEMFRMLYMVHLAAQLEEETQVRG-VVCIMDFEGLSM-KQVKALSPSFSKRLLTFI 196
            .:...::....|..:..|:|...:||.:|..:. ::.:||..||.. |::..|.....|.|..|:
 Worm   116 TYSILEVMRARMVDLEQMLHHVMELEAKTGKQAWILYVMDITGLQYNKKLYDLVTGSMKSLADFM 180

  Fly   197 QEAMPLRMKEVHFVKQ---------PFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPS 252
            .:         |:|:.         |.....::.:.:|.:.:|...::...|.     ..:.| .
 Worm   181 AD---------HYVEMIKYFVPVCVPSFATALYVVVRPLLPEKTREKVRLIGE-----TNWRD-D 230

  Fly   253 VLPANYKGTLPAI------DYGG 269
            ||......:||:|      .:||
 Worm   231 VLQYAIHSSLPSIWNNENHTFGG 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 13/44 (30%)
CRAL_TRIO 111..261 CDD:279044 31/168 (18%)
R03A10.5NP_510554.2 SEC14 77..249 CDD:214706 35/195 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.