DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and cgr-1

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:240 Identity:53/240 - (22%)
Similarity:97/240 - (40%) Gaps:54/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMKTTASFRKEYA--SLVR-GL- 98
            ||...|.:::|...||.   |.|..|..:|....:..:..:.||:        ||  :||. |: 
 Worm    22 AELRSKTKDILATYPEY---DTDFSLLRWLMGWDYKIDVIVPKMR--------YAVETLVNLGMN 75

  Fly    99 -----LVEQVKE---------KFVKGSVINVLKNCD-------QKGRRVLIVNCGKLWDPSD--- 139
                 .|:|:..         ::..|.::...|..|       .|.....:|..|    |:.   
 Worm    76 NKQTTSVDQINRDIKNMSAVAEYFPGGIMGKSKRGDVVYMQAMAKAHPKTLVKAG----PTSQLF 136

  Fly   140 ---ITSDEM-FRMLYMVHLAAQLEEETQVR-GVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEA 199
               |:..|| |:::      .|.|:||:.: ||:.|||.:|.||..:...:......|||.:|..
 Worm   137 QLCISETEMSFKII------RQTEQETERKMGVIIIMDLDGFSMDLLYTPTLKVYMSLLTMLQNI 195

  Fly   200 MPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKS 244
            .|...:.::.:..|.:.:.|:::..|.:..:...::.|...|.|:
 Worm   196 FPDFARRIYIINCPAMMSAVYAMVSPVLSSQTREKVRFLDKDWKN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 11/43 (26%)
CRAL_TRIO 111..261 CDD:279044 33/149 (22%)
cgr-1NP_508618.2 SEC14 91..257 CDD:214706 34/160 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.