DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and MOSPD2

DIOPT Version :10

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_689794.1 Gene:MOSPD2 / 158747 HGNCID:28381 Length:518 Species:Homo sapiens


Alignment Length:257 Identity:42/257 - (16%)
Similarity:93/257 - (36%) Gaps:59/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KAEAIIKLRELLKATPELNYKD------------DDAFLTVFLRACHFYPEGALEKMKTTASFRK 89
            ||:.|.:.|...:|....:..|            ||.::..:|...|...:..|:.:..:..:||
Human     9 KAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDETLKMLDESFQWRK 73

  Fly    90 EYASLVRGLLVEQVKEKFVKGSVINV----LKNCDQKGRRVLIVNCGKLWDPSDITSDEMFRMLY 150
            |       :.|..:.|..:...::.:    |...|::|.::       .|          .|:.|
Human    74 E-------ISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKL-------FW----------IRVKY 114

  Fly   151 MVH-----------LAAQLE---EETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMP 201
            .|.           :|..||   :....:.|..:.|   ||...:.::...|.:.::...:...|
Human   115 HVKDQKTILDKKKLIAFWLERYAKRENGKPVTVMFD---LSETGINSIDMDFVRFIINCFKVYYP 176

  Fly   202 LRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVLPANYKGTLP 263
            ..:.::.....|::.|..:.:.|.::..:..:.:.|  :....:|.::....||.:..||.|
Human   177 KYLSKIVIFDMPWLMNAAFKIVKTWLGPEAVSLLKF--TSKNEVQDYVSVEYLPPHMGGTDP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 10/55 (18%)
CRAL_TRIO 111..260 CDD:459890 23/166 (14%)
MOSPD2NP_689794.1 SEC14 93..234 CDD:469559 23/162 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..308
Motile_Sperm 327..431 CDD:459882
Required for FFAT motif binding and phosphorylated FFAT motif binding. /evidence=ECO:0000269|PubMed:33124732, ECO:0007744|PDB:6TQS, ECO:0007744|PDB:6TQU 365..366
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.