DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5958 and Sec14l4

DIOPT Version :9

Sequence 1:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_666125.1 Gene:Sec14l4 / 103655 MGIID:2144095 Length:403 Species:Mus musculus


Alignment Length:299 Identity:72/299 - (24%)
Similarity:129/299 - (43%) Gaps:54/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RLGYLKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGAL 78
            ::|.|.|:..| |....|||          |::||...|    |.||.||..:|||.:|..:.:.
Mouse     4 QVGDLSPQQQE-ALARFRET----------LQDLLPTLP----KADDYFLLRWLRARNFDLKKSE 53

  Fly    79 EKMKTTASFRKEYASLVRGLLVEQVKEKFVKGSVINV-----LKNCDQKGRRVLIVNCGKLWDPS 138
            :.::....||.:  ..:..:|..|..|      ||.:     |...|.:|..|.....|.: ||.
Mouse    54 DMLRKHVEFRNQ--QNLDQILTWQAPE------VIQLYDSGGLSGYDYEGCPVWFDIIGTM-DPK 109

  Fly   139 DI----TSDEMFRMLYMV--HLAAQLEEETQVRG-----VVCIMDFEGLSMKQVKALSPSFSKRL 192
            .:    :..:|.|....|  .|..:.|.::|..|     :|.:.|.||||::.:...:....::.
Mouse   110 GLFMSASKQDMIRKRIKVCEMLLHECELQSQKLGRKIERMVMVFDMEGLSLRHLWKPAVEVYQQF 174

  Fly   193 LTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMK-SLQKFLDPSVLPA 256
            ...::...|..:|.:..::.|.:|.:.::|.|.|:.::...::...|.:.| .|.||:.|..||.
Mouse   175 FAILEANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKKIVILGGNWKQELVKFVSPDQLPV 239

  Fly   257 NYKGT----------LPAIDYGG---VEWFPALEQQAQY 282
            .:.||          |..|:|||   ..::.:.:::.||
Mouse   240 EFGGTMTDPDGNPKCLTKINYGGEVPKRYYLSNQERPQY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 13/43 (30%)
CRAL_TRIO 111..261 CDD:279044 37/166 (22%)
Sec14l4NP_666125.1 CRAL_TRIO_N 13..59 CDD:215024 18/60 (30%)
SEC14 77..244 CDD:214706 38/173 (22%)
GOLD_2 284..379 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.