DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment muc and dlat-2

DIOPT Version :9

Sequence 1:NP_001260196.1 Gene:muc / 34021 FlyBaseID:FBgn0283658 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001255950.1 Gene:dlat-2 / 178524 WormBaseID:WBGene00007824 Length:337 Species:Caenorhabditis elegans


Alignment Length:230 Identity:107/230 - (46%)
Similarity:144/230 - (62%) Gaps:9/230 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 YEDIPVTNMRAVIAKRLLESKTQLPHYYVTVQCQVDKLLKFRAKVNKKYEKQGARVSVNDFIIKA 347
            ::|||::|:||.|||||..||.|:||.|..|..::|.:|..|    :|.:|.|..||:|||||||
 Worm   100 HQDIPLSNIRATIAKRLTASKQQIPHEYQGVDVRIDDILALR----QKLKKSGTAVSLNDFIIKA 160

  Fly   348 VAIASLKVPEANSAWMDTVIRKYDDVDVSVAVSTDKGLITPIVFNADRKGVLEISKDVKALAAKA 412
            .|:|...||..|..|....| ....||:||||:|..|||||||.|:|..|||.||..||.|:..|
 Worm   161 AALALRSVPTVNVRWTPEGI-GLGSVDISVAVATPTGLITPIVENSDILGVLAISSKVKELSGLA 224

  Fly   413 RDNKLQPHEFQGGTISVSNLGMFG-VNQFAAVINPPQSCILAIGTTTKQLVADPDSLKGFKEVNM 476
            |::||:|.:||||:.::||||||| |..|.|:|||||..||.||.|..::|:....|:..|   :
 Worm   225 RESKLKPQQFQGGSFTISNLGMFGSVTNFTAIINPPQCAILTIGGTRSEVVSVDGQLETQK---L 286

  Fly   477 LTVTLSADHRVVDGAVAARWLQHFRDYMEDPSNMV 511
            :.|.|..|.|.:....|.|:|.||.:.:.||..::
 Worm   287 MGVNLCFDGRAISEECAKRFLLHFSESLSDPELLI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mucNP_001260196.1 PDHac_trf_mito 83..512 CDD:273567 107/230 (47%)
lipoyl_domain 83..155 CDD:133458
2-oxoacid_dh 299..512 CDD:278621 97/214 (45%)
dlat-2NP_001255950.1 E3_binding 23..54 CDD:376939
2-oxoacid_dh 98..321 CDD:365941 107/228 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D373186at33208
OrthoFinder 1 1.000 - - FOG0001572
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23151
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.