DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and asgrl3

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_021332405.1 Gene:asgrl3 / 799269 ZFINID:ZDB-GENE-060526-152 Length:311 Species:Danio rerio


Alignment Length:242 Identity:49/242 - (20%)
Similarity:97/242 - (40%) Gaps:70/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LVNNISKAIKTEDLEQKLKDIEGNQTALSNQLKDGQKRTE-----------NQLTAIQKTLSDIE 151
            |::.|.:|.|..|:|..:.|:..:..:|:::.::.|::.|           .|:..::.::|.|.
Zfish    76 LISIIVQAKKLSDIETLMTDLSSSLDSLTSKHEENQQKLERQQNVSYIQVKKQMDTVRASVSSIM 140

  Fly   152 RKLVLQRYQQIGSRY--------FYIEHNLQ-------------------------VNWRTAEQR 183
            .||   :...:.:.:        |.|||:.:                         :||..|:..
Zfish   141 SKL---KADSVRTSFMFRHPLERFLIEHSSEELESGCSDSAWVPFGNSCYLFSRDKMNWTEAKDY 202

  Fly   184 CIEMGGHLAAFQN-------AEEYNAIVGQLNKANYWLGVNDLAKQGEFISLASGKRATYFK--W 239
            |.|.|..|...::       ..|...:....|..:||:|:.| ...|:: ..|.|...|..|  |
Zfish   203 CEEKGAWLLKIEDDSEDEWVRNECQFVTDFANPTHYWIGLTD-QNTGQW-RWADGTNYTMNKEHW 265

  Fly   240 RKNEPKYNNPTQH--------CAYVFGHENIMIVLSCTTDVMHFICQ 278
            ...:|  :..|:|        ||.: .:|:::..|.|::.: .|||:
Zfish   266 GPGQP--DEWTEHSLGEEGEDCAEI-TYESLLNDLHCSSKI-KFICE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 33/163 (20%)
asgrl3XP_021332405.1 CLECT_DC-SIGN_like 179..309 CDD:153060 30/136 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.