DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and COLEC11

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001242914.1 Gene:COLEC11 / 78989 HGNCID:17213 Length:285 Species:Homo sapiens


Alignment Length:179 Identity:40/179 - (22%)
Similarity:76/179 - (42%) Gaps:34/179 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LEQKLKDIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHNLQV 175
            |.:.:.:::...:.|:::|    |..:|.:..:::|.|.|               |..::.  :.
Human   132 LRKAIGEMDNQVSQLTSEL----KFIKNAVAGVRETESKI---------------YLLVKE--EK 175

  Fly   176 NWRTAEQRCIEMGGHLAAFQNAEEYN----AIVGQLNKANYWLGVNDLAKQGEFISLASGKRATY 236
            .:..|:..|...||.| :....|..|    |.:.|...|..::|:|||.|:|.|:........|:
Human   176 RYADAQLSCQGRGGTL-SMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTF 239

  Fly   237 FKWRKNEPKYNNPTQHCAYVF---GHENIMIVLSCTTDVMHFICQSDSD 282
            .|||..||......:.|..:.   |..::    :|.| .|:|:|:.|.:
Human   240 NKWRSGEPNNAYDEEDCVEMVASGGWNDV----ACHT-TMYFMCEFDKE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 30/120 (25%)
COLEC11NP_001242914.1 Collagen 58..111 CDD:189968
CLECT_collectin_like 165..280 CDD:153061 33/137 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5300
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.