DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Clec4a3

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001191170.1 Gene:Clec4a3 / 73149 MGIID:1920399 Length:237 Species:Mus musculus


Alignment Length:151 Identity:38/151 - (25%)
Similarity:65/151 - (43%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 TENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEY 200
            ||.:.|.....|.|.......:.::..||..::...:|..:|..:::.|..||.||....:.||.
Mouse    88 TELECTKWASLLEDKVWSCCPKDWKPFGSYCYFTSTDLVASWNESKENCFHMGAHLVVIHSQEEQ 152

  Fly   201 NAIVGQLNKAN-YWLGV-NDLAKQGEFISLASGKRATYFKWRKNEPKYNNPTQHCAYV------- 256
            :.|.|.|:... |::|: |...:|.::|........|.| |.|.||..:|  :.|..:       
Mouse   153 DFITGILDTGTAYFIGLSNPGDQQWQWIDQTPYDDNTTF-WHKGEPSSDN--EQCVIINHRQSTG 214

  Fly   257 FGHENIMIVLSCTTDVMHFIC 277
            :|..:|    .| :|..:.||
Mouse   215 WGWSDI----PC-SDKQNSIC 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 32/123 (26%)
Clec4a3NP_001191170.1 DUF2418 41..>82 CDD:287321
CLECT_DC-SIGN_like 107..230 CDD:153060 31/130 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.