DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Cd209f

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_001068161.4 Gene:Cd209f / 688750 RGDID:1585258 Length:277 Species:Rattus norvegicus


Alignment Length:214 Identity:41/214 - (19%)
Similarity:80/214 - (37%) Gaps:42/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LTATQIQIEAQQAFLVNNISKAIKTEDLEQKLKDIEGNQTALSNQLKDGQ---KRTENQLTAIQK 145
            :.||.:||        :.|....:.:..:||.....|.......|...|.   ::.:.|||....
  Rat    78 MLATLVQI--------SRICANPQGQTQDQKGSSSFGKVAVPQEQTYTGLEQIQQIQQQLTQFNA 134

  Fly   146 TLSDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEE------YNAIV 204
            :|:.:.|..........||.|.:  .....:|..:...|.::|.||....:..|      ::...
  Rat   135 SLAGLCRPCPWDWEFFQGSCYLF--SRTLASWGASASSCKDLGAHLVIVNSVAEQQFLKYWHIRQ 197

  Fly   205 GQLNKANYWLGVNDLAKQGEFISLASGKRATYFKWRKNEPKYNNPTQHCAYVFGHENIMIVL--- 266
            .||.    |:|::|..::|.:..:........| |::.||  ||.        |.|:.:::.   
  Rat   198 SQLT----WIGLSDHQREGSWQWVDDTPLKLSF-WKEGEP--NNA--------GDEDCVVIAEDK 247

  Fly   267 ----SCTTDVMHFICQSDS 281
                :|:.: ..::|:..|
  Rat   248 WNDSTCSAN-NFWVCEQPS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 23/126 (18%)
Cd209fXP_001068161.4 CLECT_DC-SIGN_like 143..262 CDD:153060 24/136 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.