DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Clec5a

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001102847.1 Gene:Clec5a / 679787 RGDID:1584755 Length:190 Species:Rattus norvegicus


Alignment Length:127 Identity:28/127 - (22%)
Similarity:45/127 - (35%) Gaps:38/127 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 NWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQGEFISLASGKRATYF--- 237
            ||...:.||.......:.::|:.:|.|..|..      |.:.|..|:.:|:...:|.. .||   
  Rat    76 NWDFHQGRCFFFSTSESPWKNSRDYCATKGST------LAIVDTPKKLKFLQDRAGAE-NYFIGL 133

  Fly   238 -------KWR--KNEPKYNNPTQ-----HCAYVFGHENIMIVLSCTTDV------MHFICQS 279
                   |||  .|.....|.|.     :|        :.|.|:.|.|.      ..:||::
  Rat   134 IRQPGEKKWRWVNNSVFKGNVTNQEQNFNC--------VTIGLTMTFDAASCDISYRWICET 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790
CLECT 164..278 CDD:153057 27/124 (22%)
Clec5aNP_001102847.1 CLECT_NK_receptors_like 73..186 CDD:153063 27/124 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.