DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and illr1

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001035139.1 Gene:illr1 / 677756 ZFINID:ZDB-GENE-050311-2 Length:253 Species:Danio rerio


Alignment Length:137 Identity:34/137 - (24%)
Similarity:57/137 - (41%) Gaps:28/137 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LKDIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIER-------KLVLQRYQQIGSRYFYIEHN 172
            :.|.|.|.|....||  ...|.::     |:||..:.|       .|...|:...|.:.:|.. .
Zfish    75 VSDQEHNVTDYMEQL--DVLRIQH-----QETLRKLNRLNQSSGCALCAVRWTHSGGKCYYFS-T 131

  Fly   173 LQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQGEFISLASGKRATYF 237
            :::||..:...|:..||||....:..|.:.:...: |..:|:|:|||..:|.:|           
Zfish   132 VKMNWTQSRDHCVTKGGHLVIITSKAEQDFLTSNV-KETHWIGLNDLDTEGHWI----------- 184

  Fly   238 KWRKNEP 244
             |..|:|
Zfish   185 -WVDNQP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 20/81 (25%)
illr1NP_001035139.1 CLECT_DC-SIGN_like 115..248 CDD:153060 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.