DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and SFTPD

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_003010.4 Gene:SFTPD / 6441 HGNCID:10803 Length:375 Species:Homo sapiens


Alignment Length:157 Identity:36/157 - (22%)
Similarity:70/157 - (44%) Gaps:23/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KDIEGNQTALSN-------QLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQIGSRYF----YI 169
            |.|.|::.|...       .|:...:..:.|:..:|...|..::..:....|.:|.:.|    ::
Human   207 KGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFV 271

  Fly   170 EHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQL----NKANYWLGVNDLAKQGEFISLAS 230
            :     .:..|:..|.:.||.||:.::|.| ||.:.||    |:|.: |.:.|...:|:| :..:
Human   272 K-----PFTEAQLLCTQAGGQLASPRSAAE-NAALQQLVVAKNEAAF-LSMTDSKTEGKF-TYPT 328

  Fly   231 GKRATYFKWRKNEPKYNNPTQHCAYVF 257
            |:...|..|...||..:..::.|..:|
Human   329 GESLVYSNWAPGEPNDDGGSEDCVEIF 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 26/102 (25%)
SFTPDNP_003010.4 Collagen 46..98 CDD:189968
Collagen 130..201 CDD:189968
Surfac_D-trimer 224..269 CDD:286141 7/44 (16%)
CLECT_collectin_like 262..375 CDD:153061 26/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5300
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.