DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and CLEC11A

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_002966.1 Gene:CLEC11A / 6320 HGNCID:10576 Length:323 Species:Homo sapiens


Alignment Length:177 Identity:41/177 - (23%)
Similarity:78/177 - (44%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GSVAKLDKIEDQLTATQIQIEAQQAFLVNNISKAIKTEDLEQKLKDIEGNQTALSNQLKDGQKRT 136
            |.:|.||....||   .:::.|....:|.      .|:.|.| |::..|:.......|::.|.|.
Human   113 GRLAGLDAGLHQL---HVRLHALDTRVVE------LTQGLRQ-LRNAAGDTRDAVQALQEAQGRA 167

  Fly   137 ENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYN 201
            |.:...::..|..:          ::|.:.|.:..:.:.. ..|:.||...||.||...:.::..
Human   168 EREHGRLEGCLKGL----------RLGHKCFLLSRDFEAQ-AAAQARCTARGGSLAQPADRQQME 221

  Fly   202 AIVGQLNKA----NY--WLGVNDLAKQGEFISLASGKRATYFKWRKN 242
            |:...|..|    |:  ||||:|...:|.:: ..:|:|.::|.|.::
Human   222 ALTRYLRAALAPYNWPVWLGVHDRRAEGLYL-FENGQRVSFFAWHRS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790 18/89 (20%)
CLECT 164..278 CDD:153057 22/85 (26%)
CLEC11ANP_002966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..106
Cell attachment site. /evidence=ECO:0000255 61..63
CLECT_tetranectin_like 177..321 CDD:153066 24/103 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..295
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.