DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and REG1B

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_006498.1 Gene:REG1B / 5968 HGNCID:9952 Length:166 Species:Homo sapiens


Alignment Length:96 Identity:26/96 - (27%)
Similarity:38/96 - (39%) Gaps:10/96 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 YFYIEHNLQVNWRTAEQRCIEM-GGHLAAFQNAEEYNAIVGQLNK------ANYWLGVNDLAKQG 223
            |.|..:.....|..|:..|..| .|:|.:.....| .|.|..|.|      :|.|:|::|..|..
Human    46 YCYYFNEDPETWVDADLYCQNMNSGNLVSVLTQAE-GAFVASLIKESSTDDSNVWIGLHDPKKNR 109

  Fly   224 EFISLASGKRATYFKWRKNEPKYNNPTQHCA 254
            .: ..:||...:|..|....|...| ..:||
Human   110 RW-HWSSGSLVSYKSWDTGSPSSAN-AGYCA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790
CLECT 164..278 CDD:153057 26/96 (27%)
REG1BNP_006498.1 CLECT 36..164 CDD:470576 26/96 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.