DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and REG1A

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_002900.2 Gene:REG1A / 5967 HGNCID:9951 Length:166 Species:Homo sapiens


Alignment Length:131 Identity:31/131 - (23%)
Similarity:48/131 - (36%) Gaps:31/131 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 YFYIEHNLQVNWRTAEQRCIEM-GGHLAAFQNAEEYNAIVGQLNKA------NYWLGVNDLAKQG 223
            |.|..:..:..|..|:..|..| .|:|.:.....| .|.|..|.|.      |.|:|::|..|..
Human    46 YCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAE-GAFVASLIKESGTDDFNVWIGLHDPKKNR 109

  Fly   224 EFISLASGKRATYFKWRKNEPKYNNPTQHCAYVFGHENIMIVLSCTT-----------DVMHFIC 277
            .: ..:||...:|..|....|...|| .:|          :.|:.:|           |...|:|
Human   110 RW-HWSSGSLVSYKSWGIGAPSSVNP-GYC----------VSLTSSTGFQKWKDVPCEDKFSFVC 162

  Fly   278 Q 278
            :
Human   163 K 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790
CLECT 164..278 CDD:153057 30/129 (23%)
REG1ANP_002900.2 CLECT 36..164 CDD:470576 31/131 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.