DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and hbl2

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_009296949.2 Gene:hbl2 / 566971 ZFINID:ZDB-GENE-070912-286 Length:253 Species:Danio rerio


Alignment Length:155 Identity:34/155 - (21%)
Similarity:68/155 - (43%) Gaps:21/155 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 ENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYN 201
            ::::..::..:..||:......::::|.:| |:...:..|:....:.|.:.||.|...:.|.|..
Zfish   108 KSEIQNLKAEIDTIEKAASFSNFRRVGQKY-YVTDGILGNFNDGIKFCKDAGGTLVVPKTAAENQ 171

  Fly   202 AIV-----GQLNKANYWLGVNDLAKQGEFISLASGKRATYFKWRKNEPKYNNPTQHCAYVFGHEN 261
            |:|     ..|:....::||.|...:|:|:.: .||:.|:..|...:|......|.|.       
Zfish   172 ALVRVSVSSALSTGKPYIGVTDRETEGQFVDI-EGKQLTFTNWGPGQPDDYRGGQDCG------- 228

  Fly   262 IMIVLSCT------TDVMHFICQSD 280
             :|.:|.|      .|:...||:.|
Zfish   229 -VIEVSGTWDDGNCGDIRPIICEID 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 29/124 (23%)
hbl2XP_009296949.2 Collagen <36..70 CDD:189968
CLECT_collectin_like 135..251 CDD:153061 30/125 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.