DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and zgc:194252

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001122180.1 Gene:zgc:194252 / 561367 ZFINID:ZDB-GENE-081022-86 Length:251 Species:Danio rerio


Alignment Length:122 Identity:28/122 - (22%)
Similarity:49/122 - (40%) Gaps:26/122 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 YFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANY-WLGVNDLAKQGEFISLA 229
            :|::  |..::|:.|::.|.:....|:...:.:........|.|.:| |:|:.:...|..:   :
Zfish    24 HFFV--NKTLSWQDAQKYCRQNYDDLSTVGSKDLEALSSNPLIKEDYFWIGLQNNRNQWIW---S 83

  Fly   230 SGKRATYFKWRKNEPK---------YNNPTQHCAYVFGHENIMIVLSCTTDVMHFIC 277
            :|:.|....|.|.||.         .|..|      |...||    .| .|.:||.|
Zfish    84 TGEEARVTFWDKGEPTILLGGNCGGVNKNT------FKASNI----GC-NDQLHFYC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 28/122 (23%)
zgc:194252NP_001122180.1 CLECT 22..131 CDD:295302 28/122 (23%)
CLECT 128..244 CDD:214480 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.