DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and colec12

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_005163514.1 Gene:colec12 / 558942 ZFINID:ZDB-GENE-030131-9807 Length:740 Species:Danio rerio


Alignment Length:113 Identity:28/113 - (24%)
Similarity:52/113 - (46%) Gaps:8/113 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 VNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLN-KANYWLGVNDLAKQGEFISLASGKRATYFK 238
            :|:..|::||..:...:....:.||...|..|:: |..:|||:.|.|::..: ....|....|.|
Zfish   625 LNFDEAKERCSNLSSSMLIINDEEEQLWIKRQISGKGYFWLGLTDSAEENIW-RWVDGSLPNYTK 688

  Fly   239 WRKNEPKY----NNPTQHCAYVFGHENIMIVLSCTTDVMHFICQSDSD 282
            |:..:|..    :...:.||.:. ||.......| |:.:.|||:..::
Zfish   689 WKPGQPDNWSHGHEAGEDCAGLI-HEASWNDFFC-TERIGFICERTNE 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 27/107 (25%)
colec12XP_005163514.1 RILP-like 145..267 CDD:304877
Collagen 468..551 CDD:189968
CLECT_DC-SIGN_like 608..731 CDD:153060 28/108 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.