DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and lectin-21Ca

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster


Alignment Length:294 Identity:92/294 - (31%)
Similarity:145/294 - (49%) Gaps:45/294 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSSTRIILCAFLLLYPYGSLIEAQEGRRYVC--LLSDPPNQCSEYCVSALQPVIDHLSKEQQD- 62
            ||......|..|:....||  |.|::    ||  :.:|     .|.|:..|.||:.::|...:. 
  Fly     1 MFQHANFFLHVFMACGLYG--IRAKD----VCPRMSTD-----KEVCLVELAPVLKYISNNHKSH 54

  Fly    63 W-GACEVKLNGSVAKLDKIEDQLTATQIQIEAQQAFLVNNISKAIKTEDLEQKLKDIEGNQTALS 126
            | .|.||::|.:..:|.|||.|...|..:|:.    :.:|:......  |..|:|:::..|..|:
  Fly    55 WNSANEVQVNETRKQLAKIEGQEKETNDKIKV----IHDNVDNEFNA--LSAKIKNVKNIQRHLA 113

  Fly   127 NQLKDGQKRTENQLTAIQKTLS-DIERKLVL------QRYQQIGSRYFYIEHNLQVNWRTAEQRC 184
            :        .|.||...:|.|: .:|.|.|:      .::|:||.|:|:||...:|:|..|...|
  Fly   114 S--------LELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMC 170

  Fly   185 IEMGGHLAAFQNAEEYNAIVGQLNKAN-----YWLGVNDLAKQGEFISLASGKRATYFKWRKNEP 244
            .:||.||...|:.:|.:||..:|...|     :||.:||:||.|||||||:|....:.||.|:.|
  Fly   171 HKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRP 235

  Fly   245 KYNNPTQHCAYVFGHENIMIVLSCTTDVMHFICQ 278
            :. ...|.|.::.|.|  |:...|:...: ||||
  Fly   236 QV-QIHQRCVHLRGGE--MMDGKCSEQFL-FICQ 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 44/118 (37%)
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 40/110 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448775
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.