DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and lectin-24A

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster


Alignment Length:304 Identity:95/304 - (31%)
Similarity:161/304 - (52%) Gaps:51/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSSTRIILCAFLLLYPYG---SLIEAQEGRRYVCLLSDP-PNQCSEYCVSALQPVIDHLSKEQQ 61
            ||..:.::|...|:.:.:.   :.||.|           | |..|:.||...|:||:::::..|.
  Fly     1 MFRLSVLVLNLLLVSHEFSAGTAKIEIQ-----------PLPALCNGYCFPTLKPVMEYVAIHQD 54

  Fly    62 DWGACEVKLNGSVAKLDKIEDQLTATQIQIEAQQAFLVNNISKAIKTEDL--EQKLKDIEGNQTA 124
            .|..| .::..:.|:.|:|:     ..||::|.:|.:.|     ||...|  ::||..:|..|.|
  Fly    55 KWNTC-TEILANEARKDQIQ-----LNIQLDALKADVSN-----IKASQLSKDEKLDRMEREQFA 108

  Fly   125 LSNQLKDGQK-------RTENQLTAIQKTLSDIERKL-----------VLQ-RYQQIGSRYFYIE 170
            :...|:...:       ||:.||.||:.|:..::.::           .|| .:::||.||||||
  Fly   109 MHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIE 173

  Fly   171 HNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKA-NYWLGVNDLAKQGEFISLASGKRA 234
            .::::||..|:.:|..||||||:.:..:|::|||.:|:.: :|:||||:..|.|:|:|.||||..
  Fly   174 EDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSC 238

  Fly   235 TYFKWRKNEPKYNNPTQHCAYVFGHENIMIVLSCTTDVMHFICQ 278
            .|.:|...||.:||..:.|..:.  ..:|.|.:||.: ..||||
  Fly   239 LYHEWGPGEPHHNNDQERCVSIL--RKLMHVGNCTYE-KRFICQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 47/114 (41%)
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 48/114 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448781
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.