DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and lectin-28C

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster


Alignment Length:285 Identity:104/285 - (36%)
Similarity:163/285 - (57%) Gaps:22/285 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFSSTRIILCAFLLLYPYGSLIEAQEGRRYVCLLSDPPNQCSEYCVSALQPVIDHLSKEQQDWGA 65
            ||....::..|.:.:....|....:|..|.||.|.||.|||..:|:.||.|:|.|:::.|:.|..
  Fly     1 MFQLKVLLYYAIIAIVINASPSGCEETDRVVCQLEDPRNQCGPFCLEALMPLIGHIAQHQEQWKT 65

  Fly    66 CEVKLNGSVAKLDKIEDQLTATQIQIEAQQAFLVNNISKAIKTEDLEQKLKDIEGNQTALSNQLK 130
            |         ||.:|:.|....:.:||:|:..|..:..|.| .||:|.:   ...::..:..||.
  Fly    66 C---------KLQEIQAQQRDIEKEIESQKTSLTESWKKII-AEDIENR---TNRSELKMEGQLS 117

  Fly   131 DGQKRTENQLTAIQKTLSDIERKL-VLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAF 194
            |.|:    .||:|..:|.::..|: :|.|:::|||||.:||..:|.||.:|...|.:|||:||:.
  Fly   118 DLQE----ALTSITTSLKNMSAKINILHRFKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASI 178

  Fly   195 QNAEEYNAIVGQLNKAN-YWLGVNDLAKQGEFISLASGKRATYFKWRKNEPKYNNPTQHCAYVFG 258
            .|..::||||.||:|.| |.:|::|||::|.|||::|||||.:.||...||.|.:..|.|..:  
  Fly   179 INEADFNAIVSQLSKDNTYMIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEHVDQRCVSI-- 241

  Fly   259 HENIMIVLSCTTDVMHFICQSDSDV 283
            |...|.|.|||:| ..:||:::.:|
  Fly   242 HNGGMWVASCTSD-FKYICEANENV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 53/114 (46%)
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 41/138 (30%)
CLECT 160..260 CDD:153057 47/102 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.