DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and lectin-46Ca

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster


Alignment Length:132 Identity:35/132 - (26%)
Similarity:63/132 - (47%) Gaps:17/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 QQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIV----GQLNKANYWLGVNDLA 220
            :::..:.||:... ::||..|:..|:..|.:||.....|::.|:|    .|:...::|.|.|||.
  Fly    38 RELNGKCFYVGIK-KINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQ 101

  Fly   221 KQGEFISLASGKRATYFKWRKNEPKYNNPTQH-----CAYVFGHENIMIVL--SCTTDVMHFICQ 278
            .:|.|..::|||...|.    .:.....|||.     |..:....|:.:||  :| .:..:|||:
  Fly   102 SEGRFKYISSGKLVRYM----GDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNC-QEKKYFICE 161

  Fly   279 SD 280
            .:
  Fly   162 QN 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 34/124 (27%)
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 35/124 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.