DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Clec4f

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_058031.2 Gene:Clec4f / 51811 MGIID:1859834 Length:548 Species:Mus musculus


Alignment Length:269 Identity:55/269 - (20%)
Similarity:103/269 - (38%) Gaps:63/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VSA-LQPVIDHLSKEQQDWGACEVKLNGSVAKLDKIEDQLTATQIQIEAQQAFLVNNISKAIKTE 109
            :|| :|.|.|.:.:..:...:.:.:|....|:..|....|..|..||:..:|.|.:..|...:.|
Mouse   256 ISAQIQTVRDGMERAGEKMNSLKKELETLTAQTQKANGHLEQTDAQIQGLKAELKSTSSLNSRIE 320

  Fly   110 DLEQKLKDIEGNQTALSNQLKD---------------GQKRTE---------------------- 137
            .:..::||.......|...|.|               .:.:||                      
Mouse   321 VVNGQMKDASRELQTLRRDLSDVSALKSNVQMLQSNLQRAKTEMQSLKADLQATKALTAKIQGEQ 385

  Fly   138 NQLTAIQKTLSDIER---------KLVLQRYQQIGSRYFYIEHNLQVNWRTAEQRCIEMGGHLAA 193
            |:|.|:|:.::..::         :|:.|.::.....::|...: :..||.||:.|...|.|||:
Mouse   386 NRLGALQEAVAAQKQEQKTQNQVLQLIAQNWKYFNGNFYYFSRD-KKPWREAEKFCTSQGAHLAS 449

  Fly   194 FQNAEEYNAIVGQLNKANYWLGVNDLAKQGEF-------ISLASGKRATYFKWRKNEP----KYN 247
            ..:.||...:|...:..::|:|:.|...:|.:       .:.|..|..    |.||:|    ..|
Mouse   450 VTSQEEQAFLVQTTSSGDHWIGLTDQGTEGIWRWVDGTPFNNAQSKGF----WGKNQPDNWRHRN 510

  Fly   248 NPTQHCAYV 256
            ...:.|.:|
Mouse   511 GEREDCVHV 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 26/104 (25%)
Clec4fNP_058031.2 PhageMin_Tail 144..411 CDD:304511 27/154 (18%)
MscS_porin 222..415 CDD:289559 28/158 (18%)
CLECT_DC-SIGN_like 414..538 CDD:153060 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.