DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and CD207

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_056532.4 Gene:CD207 / 50489 HGNCID:17935 Length:328 Species:Homo sapiens


Alignment Length:287 Identity:62/287 - (21%)
Similarity:111/287 - (38%) Gaps:73/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TRIILCAFLL---LYPYGSLIEAQEGRRYVCLLSDPPNQCSEYCVSALQPVIDHLSKEQQDWGAC 66
            |.:::.:.||   |||           |::..:||....     |..|:..:|::|....     
Human    50 TLVLVASVLLQAVLYP-----------RFMGTISDVKTN-----VQLLKGRVDNISTLDS----- 93

  Fly    67 EVKLNGSVAKLDKIEDQLTATQIQIE----------AQQAFLVNNISKA-----IKTEDLEQ--- 113
            |:|.|         .|.:.|..:||:          :|...|..::.||     |.|...|:   
Human    94 EIKKN---------SDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVST 149

  Fly   114 ------KLK-DIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEH 171
                  :|| |:| ..:||:.:::..|...|| ::.:.|..:|| .::|.|.::.....::|.. 
Human   150 LNAQIPELKSDLE-KASALNTKIRALQGSLEN-MSKLLKRQNDI-LQVVSQGWKYFKGNFYYFS- 210

  Fly   172 NLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQGEFISLASGKRATY 236
            .:...|.:|||.|:....||.:..:..|...:........||:|:.....:|::    |....|.
Human   211 LIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDW----SWVDDTP 271

  Fly   237 FK-------WRKNEPKYNNPTQHCAYV 256
            |.       |...||......:||..:
Human   272 FNKVQSVRFWIPGEPNNAGNNEHCGNI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 21/100 (21%)
CD207NP_056532.4 CLECT_DC-SIGN_like 196..321 CDD:153060 22/108 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.