DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Cd207

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_578352.4 Gene:Cd207 / 502852 RGDID:1565913 Length:332 Species:Rattus norvegicus


Alignment Length:300 Identity:61/300 - (20%)
Similarity:122/300 - (40%) Gaps:60/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TRIILCAFLLLYP--YGSLIEAQEGRRYVCLLSDPPNQCSEYCVSALQPVIDHLS-------KEQ 60
            |.|:|.|  :.||  .|.:::.:         ||         ...|:..:|::|       :|:
  Rat    59 TSIVLQA--VFYPRLMGKILDVK---------SD---------AQMLRGRVDNISTLGSDLKRER 103

  Fly    61 QDWGACEVKLNGSVAKLDKIEDQLTATQIQIEAQQAFLVNNISKAI----KTEDLEQKL----KD 117
            ......||::......|.::..::    :.:||....:.|.:....    :.::|..|:    ||
  Rat   104 GRVDDAEVQMRIVNTSLGRVRSKI----LSLEASMKIVSNQLQVLTMNWGEVDNLNAKIPELQKD 164

  Fly   118 IEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTAEQ 182
            :: ..:||:.:::..|...|| :..:.|..||| .:::.:.::.....::|.....: .|.:|||
  Rat   165 LD-KASALNTKVQGLQNSLEN-INKLLKEQSDI-LEMMSRGWKYFMGNFYYFSRTPK-TWYSAEQ 225

  Fly   183 RCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQGEFI---SLASGKRATYFKWRKNEP 244
            .||....||.:..:..|:..:....:...:|:|:.....:|::.   ..:..|..:...|...||
  Rat   226 YCISRKAHLTSVSSESEHEFLYKVADGIPHWIGLTKAGSEGDWYWVDQTSFNKEQSRRFWIPGEP 290

  Fly   245 KYNNPTQHCAYVFGHENIMI-VLSCTTD-----VMHFICQ 278
            ......:|||      ||.: .|.|..|     |..|||:
  Rat   291 NNVRNNEHCA------NIRVSALKCWNDSPCDNVYSFICK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 28/122 (23%)
Cd207XP_578352.4 DUF881 127..>190 CDD:303034 12/68 (18%)
CLECT_DC-SIGN_like 202..325 CDD:153060 29/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.