DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Cd209e

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_006248837.1 Gene:Cd209e / 501797 RGDID:1563333 Length:215 Species:Rattus norvegicus


Alignment Length:142 Identity:33/142 - (23%)
Similarity:63/142 - (44%) Gaps:9/142 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 IEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQI---GSRYFYIEHNLQVNWRT 179
            |:.::...|.:::..|.:.|.....:.:..|:|:....|..:...   |:.||:.:.  |.:|..
  Rat    46 IQVSKIPSSEEVQWEQTKQEKMYQDLSQLKSEIDSLCRLCPWDWTFFNGNCYFFSKS--QRDWHN 108

  Fly   180 AEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANY-WLGVNDLAKQGEFISLASGKRATYFK--WRK 241
            :...|.||...|...::.||.:.:.....|..| |:|::||.|:||:..|.....:...:  |.:
  Rat   109 SITACQEMEAQLVTIKSPEEQSFLQQTSKKNGYTWMGLSDLNKEGEWYWLDGSPLSDSLRNYWNE 173

  Fly   242 NEPKYNNPTQHC 253
            .:|. |...|.|
  Rat   174 GQPN-NIDGQDC 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 25/93 (27%)
Cd209eXP_006248837.1 CLECT_DC-SIGN_like 85..207 CDD:153060 26/103 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.