DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Clec4a

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001005899.2 Gene:Clec4a / 474143 RGDID:1359662 Length:240 Species:Rattus norvegicus


Alignment Length:159 Identity:40/159 - (25%)
Similarity:71/159 - (44%) Gaps:27/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LEQKLKDIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIER--KLVLQRYQQIGSRYFYIEHNL 173
            ||:| |.|:|              .|..:|..|:..|...|:  ....:.::..||..:::..:.
  Rat    76 LEEK-KAIKG--------------ITHKELNCIKNVLLMEEKSWSCCPKNWKPFGSHCYWVTKHT 125

  Fly   174 ----QVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQLNK-ANYWLGVNDLA-KQGEFISLASGK 232
                :.:|..:|:.|..||.||....:.||.:.|.|.||: |.|::|:.|.. :|.:::|.....
  Rat   126 STYSKASWNESEKNCFSMGAHLLVIHSKEEQDFITGILNRDAAYFIGLWDSGHRQWQWVSQTPYN 190

  Fly   233 RATYFKWRKNEPKYNNPTQHCAYVFGHEN 261
            .:..| |.|.||  ::..:.|. :..|.|
  Rat   191 ASATF-WHKGEP--SSDDEKCV-IINHLN 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790 12/55 (22%)
CLECT 164..278 CDD:153057 28/104 (27%)
Clec4aNP_001005899.2 ITIM motif 5..10
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..38
CLECT_DC-SIGN_like 107..235 CDD:153060 29/113 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.