DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and clec-224

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001041207.2 Gene:clec-224 / 4363112 WormBaseID:WBGene00044790 Length:195 Species:Caenorhabditis elegans


Alignment Length:118 Identity:26/118 - (22%)
Similarity:49/118 - (41%) Gaps:27/118 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 TAEQRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQGEFISLASGKRATY------- 236
            :|||.|:|:|.|||:|:..:|..::..        |.::......:.:|..|..:.|:       
 Worm    80 SAEQECVELGAHLASFETTDEATSVKN--------LVLSSPLFSDDLLSFTSSSQETWIGLSKTN 136

  Fly   237 ---FKW-RKNEPKYNNPTQHCAYVFGHENIMIVLS-------CTTDVMHFICQ 278
               :|| ..::..:.|...... |.|...:.:.:|       ||:....|||:
 Worm   137 NGAWKWVNSSDVDFTNLPDGTT-VNGASCVSMNISGIWQPKECTSTASSFICK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 25/116 (22%)
clec-224NP_001041207.2 CLECT 57..188 CDD:214480 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.