DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and MBL2

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_000233.1 Gene:MBL2 / 4153 HGNCID:6922 Length:248 Species:Homo sapiens


Alignment Length:166 Identity:38/166 - (22%)
Similarity:76/166 - (45%) Gaps:22/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KDIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQIGSRYFYIEHNLQVNWRTA 180
            |..:|:.:..:::.|           |:|..::.|::.|.....:|:|:::|.....: :.:...
Human    99 KSPDGDSSLAASERK-----------ALQTEMARIKKWLTFSLGKQVGNKFFLTNGEI-MTFEKV 151

  Fly   181 EQRCIEMGGHLAAFQNAEEYNAIVGQLNKANYWLGVNDLAKQGEFISLASGKRATYFKWRKNEPK 245
            :..|::....:|..:||.| |..:..|.|...:||:.|...:|:|:.| :|.|.||..|.:.||.
Human   152 KALCVKFQASVATPRNAAE-NGAIQNLIKEEAFLGITDEKTEGQFVDL-TGNRLTYTNWNEGEPN 214

  Fly   246 YNNPTQHCAYVF--GHENIMIVLSCTTDVMHF-ICQ 278
            .....:.|..:.  |..|   .:.|:|.  |. :|:
Human   215 NAGSDEDCVLLLKNGQWN---DVPCSTS--HLAVCE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 28/116 (24%)
MBL2NP_000233.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..113 2/13 (15%)
CLECT_collectin_like 136..246 CDD:153061 29/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5300
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.