DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and tfc

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_612091.1 Gene:tfc / 38141 FlyBaseID:FBgn0035199 Length:376 Species:Drosophila melanogaster


Alignment Length:225 Identity:47/225 - (20%)
Similarity:90/225 - (40%) Gaps:56/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 NISKAIKTEDLEQKLKDIEGNQTALSNQLKDGQKRTENQLTAIQKTLSDIERKLVLQRYQQI--- 162
            |..:..:.::.|::..|.|.:|..|:||        |:....:|::|..:|.:...|.|..|   
  Fly   157 NRKRLREEQEEEEEADDQERDQQPLANQ--------EDFDYDVQESLQSVESEQHDQYYGNIFHR 213

  Fly   163 --------------------------------GSRYFYIEHNLQVNWRTAEQRCIEMGGHLAAFQ 195
                                            |.:.:|:....:.||..|.|.|...|.|||:..
  Fly   214 DPSENEVDNDCPNCVDESQYTPNKWTMPLLKLGEKRYYLGIFFKANWFKATQYCRYHGMHLASIS 278

  Fly   196 NAEEYNAIVGQ-----LNKANYWLGVNDLAKQGEFISLASGKRATYFKWRKNEP---KY-NNPTQ 251
            :.||.:.:...     |...::|:...|||.:|.|..:|:|:..|:..|...||   :| |...:
  Fly   279 SQEENDRLEKHIRDFGLGHEHFWISGTDLADEGNFFWMATGRPITFTNWNAGEPNNFRYENGEEE 343

  Fly   252 HCAYVFGHENIMIVLS---CTTDVMHFICQ 278
            :|..::..:...:..:   |:.:. :|:|:
  Fly   344 NCLELWNRDGKGLKWNDSPCSFET-YFVCE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 30/125 (24%)
tfcNP_612091.1 CLECT 249..373 CDD:153057 31/125 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.