DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Clec4d

DIOPT Version :10

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001003707.2 Gene:Clec4d / 362432 RGDID:1303339 Length:218 Species:Rattus norvegicus


Alignment Length:84 Identity:23/84 - (27%)
Similarity:36/84 - (42%) Gaps:8/84 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 YFYIEHNLQVNWRTAEQRCIEMGGHLAAFQNAEEYNAIVGQL--NKANYWLGVN--DLAKQGEFI 226
            ||.:..|  ..|..:|:.|..|..||... |.|.....|.||  .:.:|:||::  .:..|.:::
  Rat    94 YFPLNDN--QTWHESERNCSGMSSHLVTI-NTEAEQDFVTQLLDEQFSYFLGLSYEKVEGQWQWV 155

  Fly   227 SLASGKRATYFKWRKNEPK 245
            ..........| |:..|||
  Rat   156 DKTPFNPNVVF-WKVGEPK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 MscS_porin <75..>165 CDD:432790
CLECT 164..278 CDD:153057 23/84 (27%)
Clec4dNP_001003707.2 CLECT_DC-SIGN_like 82..206 CDD:153060 23/84 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.