DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15818 and Clec4a1

DIOPT Version :9

Sequence 1:NP_609116.1 Gene:CG15818 / 34019 FlyBaseID:FBgn0031910 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001005890.1 Gene:Clec4a1 / 362430 RGDID:1359109 Length:243 Species:Rattus norvegicus


Alignment Length:156 Identity:38/156 - (24%)
Similarity:67/156 - (42%) Gaps:24/156 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 TALSNQLKD--GQKRTENQLTAIQ----KTLSDIERKL---VLQRYQQIGSRYFYIEHNLQVNWR 178
            |.|.:...|  .:|.|..||...:    |..|.:|.|:   ..:.::..||..::...: ..:|.
  Rat    71 TTLFHMYSDLLEEKNTLQQLNHAKLHCIKNHSSVEDKVWSCCPKNWKPFGSHCYFTSRD-SASWS 134

  Fly   179 TAEQRCIEMGGHLAAFQNAEEYNAIVGQLN-KANYWLGVNDLAKQGEFISLASGKRATYFKWRKN 242
            .:|::|...|.||....:.||.:.|...|| :|:|::|::|....|:            ::|...
  Rat   135 DSEEKCSHRGAHLLVIHSQEEQDFITDTLNPRAHYYVGLSDTEGHGK------------WQWVDQ 187

  Fly   243 EPKYNNPTQ-HCAYVFGHENIMIVLS 267
            .|...|.|. |.....|::...:|||
  Rat   188 TPFNQNATSWHADEPSGNKGFCVVLS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15818NP_609116.1 CLECT 164..278 CDD:153057 26/106 (25%)
Clec4a1NP_001005890.1 CLECT_DC-SIGN_like 112..238 CDD:153060 27/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.